PDB entry 1vjt

View 1vjt on RCSB PDB site
Description: Crystal structure of Alpha-glucosidase (TM0752) from Thermotoga maritima at 2.50 A resolution
Class: hydrolase
Keywords: TM0752, ALPHA-GLUCOSIDASE, STRUCTURAL GENOMICS, JCSG, PSI, Protein Structure Initiative, Joint Center for Structural Genomics, HYDROLASE
Deposited on 2004-03-22, released 2004-03-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.198
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-glucosidase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0752
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WZL1 (12-End)
      • leader sequence (10-11)
      • modified residue (12)
      • modified residue (47-48)
      • modified residue (133)
      • modified residue (147)
      • modified residue (157)
      • modified residue (160)
      • modified residue (167)
      • modified residue (260)
      • modified residue (265)
      • modified residue (267)
      • modified residue (273)
      • modified residue (337)
      • modified residue (391)
      • modified residue (427)
    Domains in SCOPe 2.07: d1vjta1, d1vjta2, d1vjta3
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vjtA (A:)
    mgsdkihhhhhhmkisiigagsvrfalqlvgdiaqteelsredthiymmdvherrlnasy
    ilarkyveelnspvkivktssldeaidgadfiintaypydpryhdsgsqrwdevtkvgek
    hgyyrgidsqelnmvstytyvlssypdmklaleiaekmkkmapkaylmqtanpvfeitqa
    vrrwtganivgfchgvagvyevfekldldpeevdwqvagvnhgiwlnrfryrgedaypll
    dewiekklpewepknpwdtqmspaamdmykfygmlpigdtvrngswkyhynletkkkwfg
    kfggidneverpkfheqlrrarerliklaeevqqnpgmklteehpeifpkgklsgeqhip
    finaiannkrvrlflnvenqgtlkdfpddvvmelpvwvdccgihrekvepdlthrikify
    lwprilrmewnleayisrdrkvleeilirdprtksyeqivqvldeifnlpfneelrryyk
    ekl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vjtA (A:)
    hhmkisiigagsvrfalqlvgdiaqteelsredthiymmdvherrlnasyilarkyveel
    nspvkivktssldeaidgadfiintaypydpryhdsgsqrwdevtkvgekhgyyrgidsq
    elnmvstytyvlssypdmklaleiaekmkkmapkaylmqtanpvfeitqavrrwtganiv
    gfchgvagvyevfekldldpeevdwqvagvnhgiwlnrfryrgedayplldewiekklpe
    wepknpwdtqmspaamdmykfygmlpigdtvrngswkyhynletkkkwfgkfggidneve
    rpkfheqlrrarerliklaeevqqnpgmklteehpeifpkgklsgeqhipfinaiannkr
    vrlflnvenqgtlkdfpddvvmelpvwvdccgihrekvepdlthrikifylwprilrmew
    nleayisrdrkvleeilirdprtksyeqivqvldeifnlpfneelrryyke