Lineage for d1vjta1 (1vjt A:1-181)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844315Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2844861Protein Putative alpha-glucosidase TM0752 [102167] (1 species)
  7. 2844862Species Thermotoga maritima [TaxId:2336] [102168] (1 PDB entry)
  8. 2844863Domain d1vjta1: 1vjt A:1-181 [100833]
    Other proteins in same PDB: d1vjta2, d1vjta3
    structural genomics
    complexed with nad

Details for d1vjta1

PDB Entry: 1vjt (more details), 2.5 Å

PDB Description: Crystal structure of Alpha-glucosidase (TM0752) from Thermotoga maritima at 2.50 A resolution
PDB Compounds: (A:) alpha-glucosidase

SCOPe Domain Sequences for d1vjta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vjta1 c.2.1.5 (A:1-181) Putative alpha-glucosidase TM0752 {Thermotoga maritima [TaxId: 2336]}
mkisiigagsvrfalqlvgdiaqteelsredthiymmdvherrlnasyilarkyveelns
pvkivktssldeaidgadfiintaypydpryhdsgsqrwdevtkvgekhgyyrgidsqel
nmvstytyvlssypdmklaleiaekmkkmapkaylmqtanpvfeitqavrrwtganivgf
c

SCOPe Domain Coordinates for d1vjta1:

Click to download the PDB-style file with coordinates for d1vjta1.
(The format of our PDB-style files is described here.)

Timeline for d1vjta1: