Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.58: Ferredoxin-like [54861] (55 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.19: Bacterial exopeptidase dimerisation domain [55031] (1 family) |
Family d.58.19.1: Bacterial exopeptidase dimerisation domain [55032] (8 proteins) |
Protein Peptidase T (tripeptidase) [75443] (2 species) |
Species Escherichia coli [TaxId:562] [103002] (1 PDB entry) |
Domain d1vixa2: 1vix A:208-320 [100778] Other proteins in same PDB: d1vixa1, d1vixb1 |
PDB Entry: 1vix (more details), 2.5 Å
SCOP Domain Sequences for d1vixa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vixa2 d.58.19.1 (A:208-320) Peptidase T (tripeptidase) {Escherichia coli [TaxId: 562]} fnaasvnikivgnnvhpgtakgvmvnalslaarihaevpadespemtegyegfyhlasmk gtveradmhyiirdfdrkqfearkrkmmeiakkvgkglhpdcyielviedsyy
Timeline for d1vixa2: