Lineage for d1vixa1 (1vix A:-1-207,A:321-409)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 702659Fold c.56: Phosphorylase/hydrolase-like [53162] (7 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 703083Superfamily c.56.5: Zn-dependent exopeptidases [53187] (8 families) (S)
    core: mixed beta-sheet of 8 strands, order 12435867; strands 2, 6 & 7 are antiparallel to the rest
  5. 703198Family c.56.5.4: Bacterial dinuclear zinc exopeptidases [53204] (17 proteins)
  6. 703287Protein Peptidase T (tripeptidase), catalytic domain [75250] (2 species)
  7. 703288Species Escherichia coli [TaxId:562] [102506] (1 PDB entry)
  8. 703289Domain d1vixa1: 1vix A:-1-207,A:321-409 [100777]
    Other proteins in same PDB: d1vixa2, d1vixb2

Details for d1vixa1

PDB Entry: 1vix (more details), 2.5 Å

PDB Description: crystal structure of a putative peptidase t
PDB Compounds: (A:) Peptidase T

SCOP Domain Sequences for d1vixa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vixa1 c.56.5.4 (A:-1-207,A:321-409) Peptidase T (tripeptidase), catalytic domain {Escherichia coli [TaxId: 562]}
msldkllerflnyvsldtqskagvrqvpstegqwkllhllkeqleemglinvtlsekgtl
matlpanvpgdipaigfishvdtspdcsgknvnpqivenyrggdialgigdevlspvmfp
vlhqllgqtlittdgktllgaddkagiaeimtalavlqqkkiphgdirvaftpdeevgkg
akhfdvdafdarwaytvdgggvgelefenXnmrekvvehphildiaqqamrdcdiepelk
pirggtdgaqlsfmglpcpnlftggynyhgkhefvtlegmekavqvivriaeltaqrke

SCOP Domain Coordinates for d1vixa1:

Click to download the PDB-style file with coordinates for d1vixa1.
(The format of our PDB-style files is described here.)

Timeline for d1vixa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vixa2