SCOPe 2.08: Domain d1vhxa1: 1vhx A:2-138

Lineage for d1vhxa1 (1vhx A:2-138)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (18 families)
   consists of one domain of this fold

5. Family c.55.3.8: Putative Holliday junction resolvase RuvX [102485] (3 proteins)
   automatically mapped to Pfam PF03652

6. Protein Hypothetical protein YrrK (RuvX) [102488] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [102489] (1 PDB entry)

8. Domain d1vhxa1: 1vhx A:2-138 [100712]
   Other proteins in same PDB: d1vhxa2, d1vhxa3, d1vhxb2
   structural genomics

Details for d1vhxa1

PDB Entry: 1vhx, 1.96 Å

PDB Description: crystal structure of putative holliday junction resolvase

PDB Compounds: (A:) Putative Holliday junction resolvase

SCOPe Domain Sequences for d1vhxa1:

Sequence; same for both SEQRES and ATOM records:

>d1vhxa1 c.55.3.8 (A:2-138) Hypothetical protein YrrK (RuvX) {Bacillus subtilis [TaxId: 1423]}
rilgldlgtktlgvalsdemgwtaqgietikineaegdyglsrlselikdytidkivlgf
pknmngtvgprgeasqtfakvlettynvpvvlwderlttmaaekmliaadvsrqkrkkvi
dkmaavmilqgyldsln

Timeline for d1vhxa1:

• d1vhxa1 first appeared in SCOP 1.67, called d1vhxa_
  
• d1vhxa1 appears in SCOPe 2.07