![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
![]() | Family c.55.3.8: Putative Holliday junction resolvase RuvX [102485] (3 proteins) automatically mapped to Pfam PF03652 |
![]() | Protein Hypothetical protein YrrK (RuvX) [102488] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [102489] (1 PDB entry) |
![]() | Domain d1vhxb1: 1vhx B:2-137 [100713] Other proteins in same PDB: d1vhxa2, d1vhxa3, d1vhxb2 structural genomics |
PDB Entry: 1vhx (more details), 1.96 Å
SCOPe Domain Sequences for d1vhxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vhxb1 c.55.3.8 (B:2-137) Hypothetical protein YrrK (RuvX) {Bacillus subtilis [TaxId: 1423]} rilgldlgtktlgvalsdemgwtaqgietikineaegdyglsrlselikdytidkivlgf pknmngtvgprgeasqtfakvlettynvpvvlwderlttmaaekmliaadvsrqkrkkvi dkmaavmilqgyldsl
Timeline for d1vhxb1: