PDB entry 1vhx

View 1vhx on RCSB PDB site
Description: Crystal structure of Putative Holliday junction resolvase
Class: hydrolase
Keywords: structural genomics, HYDROLASE
Deposited on 2003-12-01, released 2003-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative Holliday junction resolvase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YRRK, BSU27390
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34634 (3-139)
      • cloning artifact (1-2)
      • modified residue (22)
      • modified residue (66)
      • modified residue (102)
      • modified residue (107)
      • modified residue (125)
      • modified residue (129)
      • cloning artifact (140)
    Domains in SCOPe 2.07: d1vhxa1, d1vhxa2, d1vhxa3
  • Chain 'B':
    Compound: Putative Holliday junction resolvase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YRRK, BSU27390
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34634 (3-End)
      • cloning artifact (1-2)
      • modified residue (22)
      • modified residue (66)
      • modified residue (102)
      • modified residue (107)
      • modified residue (125)
      • modified residue (129)
    Domains in SCOPe 2.07: d1vhxb1, d1vhxb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vhxA (A:)
    mslrilgldlgtktlgvalsdemgwtaqgietikineaegdyglsrlselikdytidkiv
    lgfpknmngtvgprgeasqtfakvlettynvpvvlwderlttmaaekmliaadvsrqkrk
    kvidkmaavmilqgyldslneggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhxA (A:)
    slrilgldlgtktlgvalsdemgwtaqgietikineaegdyglsrlselikdytidkivl
    gfpknmngtvgprgeasqtfakvlettynvpvvlwderlttmaaekmliaadvsrqkrkk
    vidkmaavmilqgyldslne
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vhxB (B:)
    mslrilgldlgtktlgvalsdemgwtaqgietikineaegdyglsrlselikdytidkiv
    lgfpknmngtvgprgeasqtfakvlettynvpvvlwderlttmaaekmliaadvsrqkrk
    kvidkmaavmilqgyldslneggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vhxB (B:)
    slrilgldlgtktlgvalsdemgwtaqgietikineaegdyglsrlselikdytidkivl
    gfpknmngtvgprgeasqtfakvlettynvpvvlwderlttmaaekmliaadvsrqkrkk
    vidkmaavmilqgyldsl