Lineage for d1vhsa_ (1vhs A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1664276Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1664277Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1664278Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1664591Protein Putative phosphinothricin acetyltransferase YwnH [103171] (1 species)
  7. 1664592Species Bacillus subtilis [TaxId:1423] [103172] (1 PDB entry)
  8. 1664593Domain d1vhsa_: 1vhs A: [100698]
    structural genomics

Details for d1vhsa_

PDB Entry: 1vhs (more details), 1.8 Å

PDB Description: crystal structure of a putative phosphinothricin n-acetyltransferase
PDB Compounds: (A:) similar to phosphinothricin acetyltransferase

SCOPe Domain Sequences for d1vhsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]}
sltlrlaehrdleavvaiynstiasrmvtadtepvtpedrmewfsghtesrplyvaeden
gnvaawisfetfygrpaynktaevsiyideacrgkgvgsyllqealriapnlgirslmaf
ifghnkpslklfekhgfaewglfpgiaemdgkrydlkilgrelse

SCOPe Domain Coordinates for d1vhsa_:

Click to download the PDB-style file with coordinates for d1vhsa_.
(The format of our PDB-style files is described here.)

Timeline for d1vhsa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1vhsb_