Lineage for d1vhsa1 (1vhs A:2-163)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. Protein Putative phosphinothricin acetyltransferase YwnH [103171] (1 species)
  7. Species Bacillus subtilis [TaxId:1423] [103172] (1 PDB entry)
  8. Domain d1vhsa1: 1vhs A:2-163 [100698]
    Other proteins in same PDB: d1vhsa2, d1vhsa3, d1vhsb2, d1vhsb3
    structural genomics

Details for d1vhsa1

PDB Entry: 1vhs (more details), 1.8 Å

PDB Description: crystal structure of a putative phosphinothricin n-acetyltransferase
PDB Compounds: (A:) similar to phosphinothricin acetyltransferase

SCOPe Domain Sequences for d1vhsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vhsa1 d.108.1.1 (A:2-163) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]}
tlrlaehrdleavvaiynstiasrmvtadtepvtpedrmewfsghtesrplyvaedengn
vaawisfetfygrpaynktaevsiyideacrgkgvgsyllqealriapnlgirslmafif
ghnkpslklfekhgfaewglfpgiaemdgkrydlkilgrels

SCOPe Domain Coordinates for d1vhsa1 are not available.

Timeline for d1vhsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1vhsa2, d1vhsa3
View in 3D
Domains from other chains:
(mouse over for more information)
d1vhsb1, d1vhsb2, d1vhsb3