Lineage for d1vf6b_ (1vf6 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2349329Fold a.194: L27 domain [101287] (1 superfamily)
    6 helices, heterodimer of 3-helical domains
  4. 2349330Superfamily a.194.1: L27 domain [101288] (1 family) (S)
  5. 2349331Family a.194.1.1: L27 domain [101289] (6 proteins)
  6. 2349332Protein Associated tight junction protein Pals-1 [101290] (2 species)
  7. 2349333Species Human (Homo sapiens) [TaxId:9606] [101291] (1 PDB entry)
  8. 2349335Domain d1vf6b_: 1vf6 B: [100601]
    Other proteins in same PDB: d1vf6c1, d1vf6c2, d1vf6d_
    L27n domain; complexed with L27 domain of Patj

Details for d1vf6b_

PDB Entry: 1vf6 (more details), 2.1 Å

PDB Description: 2.1 angstrom crystal structure of the pals-1-l27n and patj l27 heterodimer complex
PDB Compounds: (B:) PALS1-associated tight junction protein

SCOPe Domain Sequences for d1vf6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vf6b_ a.194.1.1 (B:) Associated tight junction protein Pals-1 {Human (Homo sapiens) [TaxId: 9606]}
lqvlqvldrlkmklqekgdtsqneklsmfyetlksplfnqiltlqqsikqlkgqlnhile

SCOPe Domain Coordinates for d1vf6b_:

Click to download the PDB-style file with coordinates for d1vf6b_.
(The format of our PDB-style files is described here.)

Timeline for d1vf6b_: