Class a: All alpha proteins [46456] (290 folds) |
Fold a.194: L27 domain [101287] (1 superfamily) 6 helices, heterodimer of 3-helical domains |
Superfamily a.194.1: L27 domain [101288] (1 family) |
Family a.194.1.1: L27 domain [101289] (6 proteins) |
Protein Associated tight junction protein Pals-1 [101290] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [101291] (1 PDB entry) |
Domain d1vf6b_: 1vf6 B: [100601] Other proteins in same PDB: d1vf6c1, d1vf6c2, d1vf6d_ L27n domain; complexed with L27 domain of Patj |
PDB Entry: 1vf6 (more details), 2.1 Å
SCOPe Domain Sequences for d1vf6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vf6b_ a.194.1.1 (B:) Associated tight junction protein Pals-1 {Human (Homo sapiens) [TaxId: 9606]} lqvlqvldrlkmklqekgdtsqneklsmfyetlksplfnqiltlqqsikqlkgqlnhile
Timeline for d1vf6b_:
View in 3D Domains from other chains: (mouse over for more information) d1vf6a_, d1vf6c1, d1vf6c2, d1vf6d_ |