Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.40: V-type ATP synthase subunit C [103485] (1 superfamily) 9 transmembrane helices |
Superfamily f.40.1: V-type ATP synthase subunit C [103486] (2 families) duplication: consists of three similar structural parts automatically mapped to Pfam PF01992 |
Family f.40.1.1: V-type ATP synthase subunit C [103487] (2 proteins) |
Protein V-type ATP synthase subunit C [103488] (1 species) |
Species Thermus thermophilus [TaxId:274] [103489] (2 PDB entries) |
Domain d1v9ma_: 1v9m A: [100543] complexed with gol |
PDB Entry: 1v9m (more details), 1.85 Å
SCOPe Domain Sequences for d1v9ma_:
Sequence, based on SEQRES records: (download)
>d1v9ma_ f.40.1.1 (A:) V-type ATP synthase subunit C {Thermus thermophilus [TaxId: 274]} faylnarvrvrrgtllkesffqealdlsfadflrllsetvyggelagqglpdvdravlrt qaklvgdlprlvtgeareavrllllrndlhnlqallrakatgrpfeevlllpgtlreevw rqayeaqdpagmaqvlavpghplaralravlretqdlarveallakrffedvakaakgld qpalrdylalevdaenlrtafklqgsglapdafflkggrfvdrvrfarlmegdyavldel sgtpfsglsgvrdlkalerglrcvllkeakkgvqdplgvglvlayvkereweavrlrlla rrayfglpraqveeevvcp
>d1v9ma_ f.40.1.1 (A:) V-type ATP synthase subunit C {Thermus thermophilus [TaxId: 274]} faylnarvrvrrgtllkesffqealdlsfadflrllsetvyggelagqglpdvdravlrt qaklvgdlprlvtgeareavrllllrndlhnlqallrakatgrpfeevlllpgtlreevw rqayeaqdpagmaqvlavpghplaralravlretqdlarveallakrffedvakpalrdy lalevdaenlrtafklqgsglapdafflkggrfvdrvrfarlmegdyavldelsgtpfsg lsgvrdlkalerglrcvllkeakkgvqdplgvglvlayvkereweavrlrllarrayfgl praqveeevvcp
Timeline for d1v9ma_: