PDB entry 1v9m

View 1v9m on RCSB PDB site
Description: Crystal structure of the C subunit of V-type ATPase from Thermus thermophilus
Class: hydrolase
Keywords: VOV1-ATPASE, V-TYPE ATPASE, THE C SUBUNIT, THERMUS THERMOPHILUS, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, hydrolase
Deposited on 2004-01-26, released 2004-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.202
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: V-type ATP synthase subunit C
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v9ma_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v9mA (A:)
    maddfaylnarvrvrrgtllkesffqealdlsfadflrllsetvyggelagqglpdvdra
    vlrtqaklvgdlprlvtgeareavrllllrndlhnlqallrakatgrpfeevlllpgtlr
    eevwrqayeaqdpagmaqvlavpghplaralravlretqdlarveallakrffedvakaa
    kgldqpalrdylalevdaenlrtafklqgsglapdafflkggrfvdrvrfarlmegdyav
    ldelsgtpfsglsgvrdlkalerglrcvllkeakkgvqdplgvglvlayvkereweavrl
    rllarrayfglpraqveeevvcp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v9mA (A:)
    faylnarvrvrrgtllkesffqealdlsfadflrllsetvyggelagqglpdvdravlrt
    qaklvgdlprlvtgeareavrllllrndlhnlqallrakatgrpfeevlllpgtlreevw
    rqayeaqdpagmaqvlavpghplaralravlretqdlarveallakrffedvakpalrdy
    lalevdaenlrtafklqgsglapdafflkggrfvdrvrfarlmegdyavldelsgtpfsg
    lsgvrdlkalerglrcvllkeakkgvqdplgvglvlayvkereweavrlrllarrayfgl
    praqveeevvcp