Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.120: PIN domain-like [88722] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.120.1: PIN domain-like [88723] (4 families) |
Family c.120.1.1: PIN domain [89619] (7 proteins) Pfam PF01850 |
Protein Hypothetical protein PAE2754 [102270] (1 species) |
Species Pyrobaculum aerophilum [TaxId:13773] [102271] (2 PDB entries) |
Domain d1v8oe_: 1v8o E: [100515] Other proteins in same PDB: d1v8ob2, d1v8oc2, d1v8of2, d1v8oh2 complexed with cl |
PDB Entry: 1v8o (more details), 2.8 Å
SCOPe Domain Sequences for d1v8oe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v8oe_ c.120.1.1 (E:) Hypothetical protein PAE2754 {Pyrobaculum aerophilum [TaxId: 13773]} aveylvdasalyalaahydkwikhreklailhltiyeagnalwkearlgrvdwaaasrhl kkvmssfkvledppldevmrvavergltfydasyayvaessglvlvtqdrellaktkgai dvetllvrlaaq
Timeline for d1v8oe_: