SCOPe 2.08: Domain d1v8of1: 1v8o F:2-133

Lineage for d1v8of1 (1v8o F:2-133)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.120: PIN domain-like [88722] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.120.1: PIN domain-like [88723] (4 families)

5. Family c.120.1.1: PIN domain [89619] (7 proteins)
   Pfam PF01850

6. Protein Hypothetical protein PAE2754 [102270] (1 species)

7. Species Pyrobaculum aerophilum [TaxId:13773] [102271] (2 PDB entries)

8. Domain d1v8of1: 1v8o F:2-133 [100516]
   Other proteins in same PDB: d1v8ob2, d1v8oc2, d1v8of2, d1v8oh2
   complexed with cl

Details for d1v8of1

PDB Entry: 1v8o, 2.8 Å

PDB Description: crystal structure of pae2754 from pyrobaculum aerophilum

PDB Compounds: (F:) hypothetical protein PAE2754

SCOPe Domain Sequences for d1v8of1:

Sequence; same for both SEQRES and ATOM records:

>d1v8of1 c.120.1.1 (F:2-133) Hypothetical protein PAE2754 {Pyrobaculum aerophilum [TaxId: 13773]}
aveylvdasalyalaahydkwikhreklailhltiyeagnalwkearlgrvdwaaasrhl
kkvmssfkvledppldevmrvavergltfydasyayvaessglvlvtqdrellaktkgai
dvetllvrlaaq

Timeline for d1v8of1:

• d1v8of1 first appeared in SCOP 1.67, called d1v8of_
  
• d1v8of1 appears in SCOPe 2.07