PDB entry 1v8o

View 1v8o on RCSB PDB site
Description: Crystal Structure of PAE2754 from Pyrobaculum aerophilum
Class: structural genomics, unknown function
Keywords: PIN-domain, SeMet substituted, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2004-01-12, released 2004-02-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.226
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PAE2754
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: PAE2754
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZUJ3 (Start-157)
      • engineered (26)
      • engineered (89)
      • engineered (104)
      • enieneered (89)
      • enieneered (104)
    Domains in SCOPe 2.07: d1v8oa_
  • Chain 'B':
    Compound: hypothetical protein PAE2754
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: PAE2754
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZUJ3 (24-157)
      • modified residue (24)
      • engineered (26)
      • engineered (89)
      • engineered (104)
      • expression tag (24)
      • enieneered (89)
      • enieneered (104)
      • expression tag (24)
      • expression tag (24)
    Domains in SCOPe 2.07: d1v8ob1, d1v8ob2
  • Chain 'C':
    Compound: hypothetical protein PAE2754
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: PAE2754
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZUJ3 (23-157)
      • modified residue (23)
      • engineered (26)
      • engineered (89)
      • engineered (104)
      • expression tag (23)
      • enieneered (89)
      • enieneered (104)
      • expression tag (23)
      • expression tag (23)
    Domains in SCOPe 2.07: d1v8oc1, d1v8oc2
  • Chain 'D':
    Compound: hypothetical protein PAE2754
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: PAE2754
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZUJ3 (Start-157)
      • engineered (26)
      • engineered (89)
      • engineered (104)
      • enieneered (89)
      • enieneered (104)
    Domains in SCOPe 2.07: d1v8od_
  • Chain 'E':
    Compound: hypothetical protein PAE2754
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: PAE2754
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZUJ3 (Start-157)
      • engineered (26)
      • engineered (89)
      • engineered (104)
      • enieneered (89)
      • enieneered (104)
    Domains in SCOPe 2.07: d1v8oe_
  • Chain 'F':
    Compound: hypothetical protein PAE2754
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: PAE2754
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZUJ3 (25-157)
      • modified residue (25)
      • engineered (26)
      • engineered (89)
      • engineered (104)
      • expression tag (25)
      • enieneered (89)
      • enieneered (104)
      • expression tag (25)
      • expression tag (25)
    Domains in SCOPe 2.07: d1v8of1, d1v8of2
  • Chain 'G':
    Compound: hypothetical protein PAE2754
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: PAE2754
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZUJ3 (Start-157)
      • engineered (26)
      • engineered (89)
      • engineered (104)
      • enieneered (89)
      • enieneered (104)
    Domains in SCOPe 2.07: d1v8og_
  • Chain 'H':
    Compound: hypothetical protein PAE2754
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: PAE2754
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZUJ3 (22-157)
      • modified residue (22)
      • engineered (26)
      • engineered (89)
      • engineered (104)
      • expression tag (22)
      • enieneered (89)
      • enieneered (104)
      • expression tag (22)
      • expression tag (22)
    Domains in SCOPe 2.07: d1v8oh1, d1v8oh2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v8oA (A:)
    msyyhhhhhhdydipttenlyfqgamaveylvdasalyalaahydkwikhreklailhlt
    iyeagnalwkearlgrvdwaaasrhlkkvmssfkvledppldevmrvavergltfydasy
    ayvaessglvlvtqdrellaktkgaidvetllvrlaaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8oA (A:)
    aveylvdasalyalaahydkwikhreklailhltiyeagnalwkearlgrvdwaaasrhl
    kkvmssfkvledppldevmrvavergltfydasyayvaessglvlvtqdrellaktkgai
    dvetllvrlaaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v8oB (B:)
    msyyhhhhhhdydipttenlyfqgamaveylvdasalyalaahydkwikhreklailhlt
    iyeagnalwkearlgrvdwaaasrhlkkvmssfkvledppldevmrvavergltfydasy
    ayvaessglvlvtqdrellaktkgaidvetllvrlaaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8oB (B:)
    amaveylvdasalyalaahydkwikhreklailhltiyeagnalwkearlgrvdwaaasr
    hlkkvmssfkvledppldevmrvavergltfydasyayvaessglvlvtqdrellaktkg
    aidvetllvrlaaq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1v8oC (C:)
    msyyhhhhhhdydipttenlyfqgamaveylvdasalyalaahydkwikhreklailhlt
    iyeagnalwkearlgrvdwaaasrhlkkvmssfkvledppldevmrvavergltfydasy
    ayvaessglvlvtqdrellaktkgaidvetllvrlaaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8oC (C:)
    gamaveylvdasalyalaahydkwikhreklailhltiyeagnalwkearlgrvdwaaas
    rhlkkvmssfkvledppldevmrvavergltfydasyayvaessglvlvtqdrellaktk
    gaidvetllvrlaaq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1v8oD (D:)
    msyyhhhhhhdydipttenlyfqgamaveylvdasalyalaahydkwikhreklailhlt
    iyeagnalwkearlgrvdwaaasrhlkkvmssfkvledppldevmrvavergltfydasy
    ayvaessglvlvtqdrellaktkgaidvetllvrlaaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8oD (D:)
    aveylvdasalyalaahydkwikhreklailhltiyeagnalwkearlgrvdwaaasrhl
    kkvmssfkvledppldevmrvavergltfydasyayvaessglvlvtqdrellaktkgai
    dvetllvrlaaq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1v8oE (E:)
    msyyhhhhhhdydipttenlyfqgamaveylvdasalyalaahydkwikhreklailhlt
    iyeagnalwkearlgrvdwaaasrhlkkvmssfkvledppldevmrvavergltfydasy
    ayvaessglvlvtqdrellaktkgaidvetllvrlaaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8oE (E:)
    aveylvdasalyalaahydkwikhreklailhltiyeagnalwkearlgrvdwaaasrhl
    kkvmssfkvledppldevmrvavergltfydasyayvaessglvlvtqdrellaktkgai
    dvetllvrlaaq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1v8oF (F:)
    msyyhhhhhhdydipttenlyfqgamaveylvdasalyalaahydkwikhreklailhlt
    iyeagnalwkearlgrvdwaaasrhlkkvmssfkvledppldevmrvavergltfydasy
    ayvaessglvlvtqdrellaktkgaidvetllvrlaaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8oF (F:)
    maveylvdasalyalaahydkwikhreklailhltiyeagnalwkearlgrvdwaaasrh
    lkkvmssfkvledppldevmrvavergltfydasyayvaessglvlvtqdrellaktkga
    idvetllvrlaaq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1v8oG (G:)
    msyyhhhhhhdydipttenlyfqgamaveylvdasalyalaahydkwikhreklailhlt
    iyeagnalwkearlgrvdwaaasrhlkkvmssfkvledppldevmrvavergltfydasy
    ayvaessglvlvtqdrellaktkgaidvetllvrlaaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8oG (G:)
    aveylvdasalyalaahydkwikhreklailhltiyeagnalwkearlgrvdwaaasrhl
    kkvmssfkvledppldevmrvavergltfydasyayvaessglvlvtqdrellaktkgai
    dvetllvrlaaq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1v8oH (H:)
    msyyhhhhhhdydipttenlyfqgamaveylvdasalyalaahydkwikhreklailhlt
    iyeagnalwkearlgrvdwaaasrhlkkvmssfkvledppldevmrvavergltfydasy
    ayvaessglvlvtqdrellaktkgaidvetllvrlaaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v8oH (H:)
    qgamaveylvdasalyalaahydkwikhreklailhltiyeagnalwkearlgrvdwaaa
    srhlkkvmssfkvledppldevmrvavergltfydasyayvaessglvlvtqdrellakt
    kgaidvetllvrlaaq