![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies) 4 helices; bundle, left-handed twist; right-handed superhelix |
![]() | Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) ![]() automatically mapped to Pfam PF02885 |
![]() | Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins) |
![]() | Protein Anthranilate phosphoribosyltransferase (TrpD) [81774] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [101213] (2 PDB entries) |
![]() | Domain d1v8gb1: 1v8g B:1-65 [100507] Other proteins in same PDB: d1v8ga2, d1v8gb2 |
PDB Entry: 1v8g (more details), 2.1 Å
SCOPe Domain Sequences for d1v8gb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v8gb1 a.46.2.1 (B:1-65) Anthranilate phosphoribosyltransferase (TrpD) {Thermus thermophilus [TaxId: 274]} mdavkkailgevleeeeayevmralmagevspvraagllvalslrgerpheiaamaramr eaarp
Timeline for d1v8gb1: