SCOPe 2.08: Domain d1v8gb1: 1v8g B:1-65

Lineage for d1v8gb1 (1v8g B:1-65)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
   4 helices; bundle, left-handed twist; right-handed superhelix

4. Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families)
   automatically mapped to Pfam PF02885

5. Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins)

6. Protein Anthranilate phosphoribosyltransferase (TrpD) [81774] (3 species)

7. Species Thermus thermophilus [TaxId:274] [101213] (2 PDB entries)

8. Domain d1v8gb1: 1v8g B:1-65 [100507]
   Other proteins in same PDB: d1v8ga2, d1v8gb2

Details for d1v8gb1

PDB Entry: 1v8g, 2.1 Å

PDB Description: Crystal structure of anthranilate phosphoribosyltransferase (TrpD) from Thermus thermophilus HB8

PDB Compounds: (B:) Anthranilate phosphoribosyltransferase

SCOPe Domain Sequences for d1v8gb1:

Sequence; same for both SEQRES and ATOM records:

>d1v8gb1 a.46.2.1 (B:1-65) Anthranilate phosphoribosyltransferase (TrpD) {Thermus thermophilus [TaxId: 274]}
mdavkkailgevleeeeayevmralmagevspvraagllvalslrgerpheiaamaramr
eaarp

Timeline for d1v8gb1:

• d1v8gb1 first appeared in SCOP 1.67
  
• d1v8gb1 appears in SCOPe 2.07