Lineage for d1v8gb1 (1v8g B:1-65)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2714352Fold a.46: Methionine synthase domain-like [47643] (3 superfamilies)
    4 helices; bundle, left-handed twist; right-handed superhelix
  4. 2714363Superfamily a.46.2: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47648] (2 families) (S)
    automatically mapped to Pfam PF02885
  5. 2714364Family a.46.2.1: Nucleoside phosphorylase/phosphoribosyltransferase N-terminal domain [47649] (3 proteins)
  6. 2714365Protein Anthranilate phosphoribosyltransferase (TrpD) [81774] (3 species)
  7. 2714400Species Thermus thermophilus [TaxId:274] [101213] (2 PDB entries)
  8. 2714406Domain d1v8gb1: 1v8g B:1-65 [100507]
    Other proteins in same PDB: d1v8ga2, d1v8gb2

Details for d1v8gb1

PDB Entry: 1v8g (more details), 2.1 Å

PDB Description: Crystal structure of anthranilate phosphoribosyltransferase (TrpD) from Thermus thermophilus HB8
PDB Compounds: (B:) Anthranilate phosphoribosyltransferase

SCOPe Domain Sequences for d1v8gb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v8gb1 a.46.2.1 (B:1-65) Anthranilate phosphoribosyltransferase (TrpD) {Thermus thermophilus [TaxId: 274]}
mdavkkailgevleeeeayevmralmagevspvraagllvalslrgerpheiaamaramr
eaarp

SCOPe Domain Coordinates for d1v8gb1:

Click to download the PDB-style file with coordinates for d1v8gb1.
(The format of our PDB-style files is described here.)

Timeline for d1v8gb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1v8gb2