Lineage for d1v7mm2 (1v7m M:108-212)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2023413Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 2023645Species Mouse (Mus musculus) [TaxId:10090] [88567] (355 PDB entries)
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region
  8. 2023936Domain d1v7mm2: 1v7m M:108-212 [100457]
    Other proteins in same PDB: d1v7mh1, d1v7mh2, d1v7mi1, d1v7mi2, d1v7ml1, d1v7mm1, d1v7mv_, d1v7mx_
    part of anti-trombopoetin Fab tn1

Details for d1v7mm2

PDB Entry: 1v7m (more details), 2.51 Å

PDB Description: Human Thrombopoietin Functional Domain Complexed To Neutralizing Antibody TN1 Fab
PDB Compounds: (M:) Monoclonal TN1 Fab Light Chain

SCOPe Domain Sequences for d1v7mm2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v7mm2 b.1.1.2 (M:108-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrne

SCOPe Domain Coordinates for d1v7mm2:

Click to download the PDB-style file with coordinates for d1v7mm2.
(The format of our PDB-style files is described here.)

Timeline for d1v7mm2: