PDB entry 1v7m

View 1v7m on RCSB PDB site
Description: Human Thrombopoietin Functional Domain Complexed To Neutralizing Antibody TN1 Fab
Class: immune system/cytokine
Keywords: Thrombopoietin, Fab fragment, Complex (Cytokine/Antibody), IMMUNE SYSTEM/CYTOKINE COMPLEX
Deposited on 2003-12-18, released 2004-03-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.51 Å
R-factor: 0.232
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Monoclonal TN1 Fab Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V7M (0-216)
    Domains in SCOPe 2.07: d1v7mh1, d1v7mh2
  • Chain 'I':
    Compound: Monoclonal TN1 Fab Heavy Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V7M (0-216)
    Domains in SCOPe 2.07: d1v7mi1, d1v7mi2
  • Chain 'L':
    Compound: Monoclonal TN1 Fab Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V7M (0-End)
    Domains in SCOPe 2.07: d1v7ml1, d1v7ml2
  • Chain 'M':
    Compound: Monoclonal TN1 Fab Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1V7M (0-End)
    Domains in SCOPe 2.07: d1v7mm1, d1v7mm2
  • Chain 'V':
    Compound: Thrombopoietin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v7mv_
  • Chain 'X':
    Compound: Thrombopoietin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v7mx_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v7mH (H:)
    evkleesggglvqpggsmklscaasgftfsdawmdwvrqspekglewvaeirskvnnhai
    hyaesvkgrftvsrddskssvylqmnslraedtgiyycsgwsflywgqgtlvtvsaaktt
    ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1v7mI (I:)
    evkleesggglvqpggsmklscaasgftfsdawmdwvrqspekglewvaeirskvnnhai
    hyaesvkgrftvsrddskssvylqmnslraedtgiyycsgwsflywgqgtlvtvsaaktt
    ppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
    sssvtvpsstwpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1v7mL (L:)
    qvvltqspgimsaspgekvtitcsasssvsymywfqqkpgtspklwiystsnlasgvpar
    frgsgsgtsysltisrmeaedaatyycqqrsgyprtfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7mL (L:)
    qvvltqspgimsaspgekvtitcsasssvsymywfqqkpgtspklwiystsnlasgvpar
    frgsgsgtsysltisrmeaedaatyycqqrsgyprtfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1v7mM (M:)
    qvvltqspgimsaspgekvtitcsasssvsymywfqqkpgtspklwiystsnlasgvpar
    frgsgsgtsysltisrmeaedaatyycqqrsgyprtfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7mM (M:)
    qvvltqspgimsaspgekvtitcsasssvsymywfqqkpgtspklwiystsnlasgvpar
    frgsgsgtsysltisrmeaedaatyycqqrsgyprtfgggtkleikradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1v7mV (V:)
    spappacdlrvlskllrdshvlhsrlsqcpevhplptpvllpavdfslgewktqmeetka
    qdilgavtlllegvmaargqlgptclssllgqlsgqvrlllgalqsllgtqlppqgrtta
    hkdpnaiflsfqhllrgkvrflmlvggstlcvrrappttavps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7mV (V:)
    cdlrvlskllrdshvlhsrlsqcpevhplptpvllpavdfslgewktqmeetkaqdilga
    vtlllegvmaargqlgptclssllgqlsgqvrlllgalqsllgtqlppqgrttahkdpna
    iflsfqhllrgkvrflmlvggstlc
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1v7mX (X:)
    spappacdlrvlskllrdshvlhsrlsqcpevhplptpvllpavdfslgewktqmeetka
    qdilgavtlllegvmaargqlgptclssllgqlsgqvrlllgalqsllgtqlppqgrtta
    hkdpnaiflsfqhllrgkvrflmlvggstlcvrrappttavps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v7mX (X:)
    cdlrvlskllrdshvlhsrlsqcpevhplptpvllpavdfslgewktqmeetkaqdilga
    vtlllegvmaargqlgptclssllgqlsgqvrlllgalqsllgtqlppqgrttahkdpna
    iflsfqhllrgkvrflmlvggstlc