Lineage for d1v7mx_ (1v7m X:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705548Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 2705713Protein Thrombopoietin [101140] (1 species)
    long chain cytokine with a short-chain cytokine topology
  7. 2705714Species Human (Homo sapiens) [TaxId:9606] [101141] (2 PDB entries)
  8. 2705716Domain d1v7mx_: 1v7m X: [100459]
    Other proteins in same PDB: d1v7mh1, d1v7mh2, d1v7mi1, d1v7mi2, d1v7ml1, d1v7ml2, d1v7mm1, d1v7mm2

Details for d1v7mx_

PDB Entry: 1v7m (more details), 2.51 Å

PDB Description: Human Thrombopoietin Functional Domain Complexed To Neutralizing Antibody TN1 Fab
PDB Compounds: (X:) Thrombopoietin

SCOPe Domain Sequences for d1v7mx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v7mx_ a.26.1.2 (X:) Thrombopoietin {Human (Homo sapiens) [TaxId: 9606]}
cdlrvlskllrdshvlhsrlsqcpevhplptpvllpavdfslgewktqmeetkaqdilga
vtlllegvmaargqlgptclssllgqlsgqvrlllgalqsllgtqlppqgrttahkdpna
iflsfqhllrgkvrflmlvggstlc

SCOPe Domain Coordinates for d1v7mx_:

Click to download the PDB-style file with coordinates for d1v7mx_.
(The format of our PDB-style files is described here.)

Timeline for d1v7mx_: