SCOPe 2.06: Domain d1v6hc_: 1v6h C:

Lineage for d1v6hc_ (1v6h C:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (4 proteins)

6. Protein Cut A1 [89931] (5 species)

7. Species Thermus thermophilus [TaxId:274] [89932] (2 PDB entries)

8. Domain d1v6hc_: 1v6h C: [100382]
   structural genomics
   complexed with so4

Details for d1v6hc_

PDB Entry: 1v6h, 1.9 Å

PDB Description: The Trimeric Structure Of Divalent Cation Tolerance Protein CutA1 From Thermus Thermophilus HB8

PDB Compounds: (C:) Divalent Cation Tolerance Protein CutA1

SCOPe Domain Sequences for d1v6hc_:

Sequence; same for both SEQRES and ATOM records:

>d1v6hc_ d.58.5.2 (C:) Cut A1 {Thermus thermophilus [TaxId: 274]}
meevvlitvpseevartiakalveerlaacvnivpgltsiyrwqgevvedqellllvktt
thafpklkervkalhpytvpeivalpiaegnreyldwlrentg

Timeline for d1v6hc_:

• d1v6hc_ first appeared in SCOP 1.67
  
• d1v6hc_ appears in SCOPe 2.05
  
• d1v6hc_ appears in SCOPe 2.07
  
• d1v6hc_ appears in the current release, SCOPe 2.08