Class d: Alpha and beta proteins (a+b) [53931] (260 folds) |
Fold d.58: Ferredoxin-like [54861] (48 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (4 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.2: Divalent ion tolerance proteins CutA (CutA1) [75434] (3 proteins) |
Protein Cut A1 [89931] (4 species) |
Species Thermus thermophilus [TaxId:274] [89932] (2 PDB entries) |
Domain d1v6hc_: 1v6h C: [100382] structural genomics complexed with so4 |
PDB Entry: 1v6h (more details), 1.9 Å
SCOP Domain Sequences for d1v6hc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v6hc_ d.58.5.2 (C:) Cut A1 {Thermus thermophilus} meevvlitvpseevartiakalveerlaacvnivpgltsiyrwqgevvedqellllvktt thafpklkervkalhpytvpeivalpiaegnreyldwlrentg
Timeline for d1v6hc_: