Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families) |
Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (3 proteins) |
Protein N-(5'phosphoribosyl)antranilate isomerase, PRAI [51382] (3 species) |
Species Thermus thermophilus [TaxId:274] [102036] (1 PDB entry) |
Domain d1v5xa_: 1v5x A: [100377] |
PDB Entry: 1v5x (more details), 2 Å
SCOP Domain Sequences for d1v5xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1v5xa_ c.1.2.4 (A:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermus thermophilus [TaxId: 274]} mrvkicgitrledallaealgafalgfvlapgsrrriapeaaraigealgpfvvrvgvfr dqppeevlrlmeearlqvaqlhgeeppewaeavgrfypvikafplegparpewadypaqa llldgkrpgsgeayprawakpllatgrrvilaggiapenleevlalrpyaldlasgveea pgvksaeklralfarlaslr
Timeline for d1v5xa_: