Lineage for d1v5xa_ (1v5x A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826663Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2827194Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)
  6. 2827213Protein N-(5'phosphoribosyl)antranilate isomerase, PRAI [51382] (3 species)
  7. 2827221Species Thermus thermophilus [TaxId:274] [102036] (1 PDB entry)
  8. 2827222Domain d1v5xa_: 1v5x A: [100377]

Details for d1v5xa_

PDB Entry: 1v5x (more details), 2 Å

PDB Description: Crystal structure of Phosphoribosyl anthranilate isomerase from Thermus Thermophilus
PDB Compounds: (A:) Phosphoribosylanthranilate isomerase

SCOPe Domain Sequences for d1v5xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1v5xa_ c.1.2.4 (A:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermus thermophilus [TaxId: 274]}
mrvkicgitrledallaealgafalgfvlapgsrrriapeaaraigealgpfvvrvgvfr
dqppeevlrlmeearlqvaqlhgeeppewaeavgrfypvikafplegparpewadypaqa
llldgkrpgsgeayprawakpllatgrrvilaggiapenleevlalrpyaldlasgveea
pgvksaeklralfarlaslr

SCOPe Domain Coordinates for d1v5xa_:

Click to download the PDB-style file with coordinates for d1v5xa_.
(The format of our PDB-style files is described here.)

Timeline for d1v5xa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1v5xb_