SCOP 1.73: Domain d1v5xb_: 1v5x B:

Lineage for d1v5xb_ (1v5x B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (6 families)

5. Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (3 proteins)

6. Protein N-(5'phosphoribosyl)antranilate isomerase, PRAI [51382] (3 species)

7. Species Thermus thermophilus [TaxId:274] [102036] (1 PDB entry)

8. Domain d1v5xb_: 1v5x B: [100378]

Details for d1v5xb_

PDB Entry: 1v5x, 2 Å

PDB Description: Crystal structure of Phosphoribosyl anthranilate isomerase from Thermus Thermophilus

PDB Compounds: (B:) Phosphoribosylanthranilate isomerase

SCOP Domain Sequences for d1v5xb_:

Sequence; same for both SEQRES and ATOM records:

>d1v5xb_ c.1.2.4 (B:) N-(5'phosphoribosyl)antranilate isomerase, PRAI {Thermus thermophilus [TaxId: 274]}
mrvkicgitrledallaealgafalgfvlapgsrrriapeaaraigealgpfvvrvgvfr
dqppeevlrlmeearlqvaqlhgeeppewaeavgrfypvikafplegparpewadypaqa
llldgkrpgsgeayprawakpllatgrrvilaggiapenleevlalrpyaldlasgveea
pgvksaeklralfarlaslr

Timeline for d1v5xb_:

• d1v5xb_ first appeared in SCOP 1.67
  
• d1v5xb_ appears in SCOP 1.71
  
• d1v5xb_ appears in SCOP 1.75
  
• d1v5xb_ appears in the current release, SCOPe 2.08