Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) shares functional and structural similarities with the ATP-grasp fold and PIPK |
Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins) members organized in the groups and subfamiles specified by the comments |
Protein Cyclin-dependent PK, CDK2 [88855] (2 species) CMGC group; CDKs subfamily; serine/threonine kinase |
Species (Plasmodium falciparum) [TaxId:5833] [103289] (4 PDB entries) CDK2 homologue Pfpk5 |
Domain d1v0pb_: 1v0p B: [100246] complexed with pvb; mutant |
PDB Entry: 1v0p (more details), 2 Å
SCOP Domain Sequences for d1v0pb_:
Sequence, based on SEQRES records: (download)
>d1v0pb_ d.144.1.7 (B:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} ekyhglekigegtygvvykaqnnygetfalkkirlekedegipsttireisilkelkhsn ivklydvihtkkrlvlvfehldqdlkklldvcegglesvtaksfllqllngiaychdrrv lhrdlkpqnllinregelkiadfglarafgipvrkytheivtlwyrapdvlmgskkystt idiwsvgcifaemvngtplfpgvseadqlmrifrilgtpnsknwpnvtelpkydpnftvy eplpwesflkgldesgidllskmlkldpnqritakqalehayfke
>d1v0pb_ d.144.1.7 (B:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} ekyhglekigegtygvvykaqnnygetfalkpsttireisilkelkhsnivklydvihtl vlvfehldqdlkklldvcegglesvtaksfllqllngiaychdrrvlhrdlkpqnllinr egelkiadfglaraflwyrapdvlmgskkysttidiwsvgcifaemvngtplfpgvsead qlmrifrilgtpnsknwpnvtelpkydpnftvyeplpwesflkgldesgidllskmlkld pnqritakqalehayfke
Timeline for d1v0pb_: