Lineage for d1v0ob_ (1v0o B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [103289] (4 PDB entries)
    CDK2 homologue Pfpk5
  8. Domain d1v0ob_: 1v0o B: [100244]
    complexed with inr

Details for d1v0ob_

PDB Entry: 1v0o (more details), 1.9 Å

PDB Description: structure of p. falciparum pfpk5-indirubin-5-sulphonate ligand complex
PDB Compounds: (B:) cell division control protein 2 homolog

SCOPe Domain Sequences for d1v0ob_:

Sequence, based on SEQRES records: (download)

>d1v0ob_ d.144.1.7 (B:) Cyclin-dependent PK, CDK2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
kyhglekigegtygvvykaqnnygetfalkkirlekedegipsttireisilkelkhsni
vklydvihtkkrlvlvfehldqdlkklldvcegglesvtaksfllqllngiaychdrrvl
hrdlkpqnllinregelkiadfglarafgipvrkythevvtlwyrapdvlmgskkystti
diwsvgcifaemvngtplfpgvseadqlmrifrilgtpnsknwpnvtelpkydpnftvye
plpwesflkgldesgidllskmlkldpnqritakqalehayfken

Sequence, based on observed residues (ATOM records): (download)

>d1v0ob_ d.144.1.7 (B:) Cyclin-dependent PK, CDK2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
kyhglekigegtygvvykaqnnygetfalkkirltireisilkelkhsnivklydvihtk
krlvlvfehldqdlkklldvcegglesvtaksfllqllngiaychdrrvlhrdlkpqnll
inregelkiadfglarafgipvrkythevvtlwyrapdvlmgskkysttidiwsvgcifa
emvngtplfpgvseadqlmrifrilgtpnsknwpnvtelpkydpnftvyeplpwesflkg
ldesgidllskmlkldpnqritakqalehayfken

SCOPe Domain Coordinates for d1v0ob_ are not available.

Timeline for d1v0ob_:

Domains from other chains:
(mouse over for more information)
d1v0oa_