![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein Cyclin-dependent PK, CDK2 [88855] (2 species) CMGC group; CDKs subfamily; serine/threonine kinase |
![]() | Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [103289] (4 PDB entries) CDK2 homologue Pfpk5 |
![]() | Domain d1v0ob_: 1v0o B: [100244] complexed with inr |
PDB Entry: 1v0o (more details), 1.9 Å
SCOPe Domain Sequences for d1v0ob_:
Sequence, based on SEQRES records: (download)
>d1v0ob_ d.144.1.7 (B:) Cyclin-dependent PK, CDK2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} kyhglekigegtygvvykaqnnygetfalkkirlekedegipsttireisilkelkhsni vklydvihtkkrlvlvfehldqdlkklldvcegglesvtaksfllqllngiaychdrrvl hrdlkpqnllinregelkiadfglarafgipvrkythevvtlwyrapdvlmgskkystti diwsvgcifaemvngtplfpgvseadqlmrifrilgtpnsknwpnvtelpkydpnftvye plpwesflkgldesgidllskmlkldpnqritakqalehayfken
>d1v0ob_ d.144.1.7 (B:) Cyclin-dependent PK, CDK2 {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} kyhglekigegtygvvykaqnnygetfalkkirltireisilkelkhsnivklydvihtk krlvlvfehldqdlkklldvcegglesvtaksfllqllngiaychdrrvlhrdlkpqnll inregelkiadfglarafgipvrkythevvtlwyrapdvlmgskkysttidiwsvgcifa emvngtplfpgvseadqlmrifrilgtpnsknwpnvtelpkydpnftvyeplpwesflkg ldesgidllskmlkldpnqritakqalehayfken
Timeline for d1v0ob_: