PDB entry 1v0o

View 1v0o on RCSB PDB site
Description: structure of p. falciparum pfpk5-indirubin-5-sulphonate ligand complex
Class: transferase
Keywords: transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, cdk
Deposited on 2004-03-31, released 2004-04-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.23262
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division control protein 2 homolog
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v0oa_
  • Chain 'B':
    Compound: cell division control protein 2 homolog
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1v0ob_
  • Heterogens: INR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1v0oA (A:)
    mekyhglekigegtygvvykaqnnygetfalkkirlekedegipsttireisilkelkhs
    nivklydvihtkkrlvlvfehldqdlkklldvcegglesvtaksfllqllngiaychdrr
    vlhrdlkpqnllinregelkiadfglarafgipvrkythevvtlwyrapdvlmgskkyst
    tidiwsvgcifaemvngtplfpgvseadqlmrifrilgtpnsknwpnvtelpkydpnftv
    yeplpwesflkgldesgidllskmlkldpnqritakqalehayfkenn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v0oA (A:)
    kyhglekigegtygvvykaqnnygetfalkkirlsttireisilkelkhsnivklydvih
    tkkrlvlvfehldqdlkklldvcegglesvtaksfllqllngiaychdrrvlhrdlkpqn
    llinregelkiadfglarafgipvrkythevvtlwyrapdvlmgskkysttidiwsvgci
    faemvngtplfpgvseadqlmrifrilgtpnsknwpnvtelpkydpnftvyeplpwesfl
    kgldesgidllskmlkldpnqritakqalehayfken
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1v0oB (B:)
    mekyhglekigegtygvvykaqnnygetfalkkirlekedegipsttireisilkelkhs
    nivklydvihtkkrlvlvfehldqdlkklldvcegglesvtaksfllqllngiaychdrr
    vlhrdlkpqnllinregelkiadfglarafgipvrkythevvtlwyrapdvlmgskkyst
    tidiwsvgcifaemvngtplfpgvseadqlmrifrilgtpnsknwpnvtelpkydpnftv
    yeplpwesflkgldesgidllskmlkldpnqritakqalehayfkenn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1v0oB (B:)
    kyhglekigegtygvvykaqnnygetfalkkirltireisilkelkhsnivklydvihtk
    krlvlvfehldqdlkklldvcegglesvtaksfllqllngiaychdrrvlhrdlkpqnll
    inregelkiadfglarafgipvrkythevvtlwyrapdvlmgskkysttidiwsvgcifa
    emvngtplfpgvseadqlmrifrilgtpnsknwpnvtelpkydpnftvyeplpwesflkg
    ldesgidllskmlkldpnqritakqalehayfken