Lineage for d1uz5a3 (1uz5 A:181-328)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2127256Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 2127257Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) (S)
  5. 2127351Family c.57.1.2: MoeA central domain-like [64103] (2 protein domains)
    automatically mapped to Pfam PF00994
  6. 2127359Protein MoeA, central domain [64104] (4 species)
  7. 2127394Species Pyrococcus horikoshii, PH0582 [TaxId:53953] [102520] (1 PDB entry)
  8. 2127395Domain d1uz5a3: 1uz5 A:181-328 [100219]
    Other proteins in same PDB: d1uz5a1, d1uz5a2
    complexed with so4

Details for d1uz5a3

PDB Entry: 1uz5 (more details), 2.05 Å

PDB Description: the crystal structure of molybdopterin biosynthesis moea protein from pyrococcus horikosii
PDB Compounds: (A:) 402aa long hypothetical molybdopterin biosynthesis moea protein

SCOPe Domain Sequences for d1uz5a3:

Sequence, based on SEQRES records: (download)

>d1uz5a3 c.57.1.2 (A:181-328) MoeA, central domain {Pyrococcus horikoshii, PH0582 [TaxId: 53953]}
pkvavistgneivppgnelkpgqiydingralcdainelggegifmgvarddkeslkali
ekavnvgdvvvisggasggtkdltasvieelgevkvhgiaiqpgkptiigvikgkpvfgl
pgyptscltnftllvvplllralgregk

Sequence, based on observed residues (ATOM records): (download)

>d1uz5a3 c.57.1.2 (A:181-328) MoeA, central domain {Pyrococcus horikoshii, PH0582 [TaxId: 53953]}
pkvavistgneivppgnelkpgqiydingralcdainelggegifmgvarddkeslkali
ekavnvgdvvvisggadltasvieelgevkvhgiaiqpgkptiigvikgkpvfglpgypt
scltnftllvvplllralgregk

SCOPe Domain Coordinates for d1uz5a3:

Click to download the PDB-style file with coordinates for d1uz5a3.
(The format of our PDB-style files is described here.)

Timeline for d1uz5a3: