![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
![]() | Superfamily b.85.6: MoeA C-terminal domain-like [63867] (2 families) ![]() automatically mapped to Pfam PF03454 |
![]() | Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins) |
![]() | Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (4 species) |
![]() | Species Pyrococcus horikoshii, PH0582 [TaxId:53953] [102009] (1 PDB entry) |
![]() | Domain d1uz5a1: 1uz5 A:329-402 [100217] Other proteins in same PDB: d1uz5a2, d1uz5a3 complexed with so4 |
PDB Entry: 1uz5 (more details), 2.05 Å
SCOPe Domain Sequences for d1uz5a1:
Sequence, based on SEQRES records: (download)
>d1uz5a1 b.85.6.1 (A:329-402) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Pyrococcus horikoshii, PH0582 [TaxId: 53953]} igkkvarlkhkvfsvkgrrqflpvklegdlavpilkgsgavtsfidadgfveipetvesl degeevevtlfkgw
>d1uz5a1 b.85.6.1 (A:329-402) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Pyrococcus horikoshii, PH0582 [TaxId: 53953]} igkkvarlkhkvfsvrrqflpvklegdlavpilkgsgavtsfidadgfveipetveslde geevevtlfkgw
Timeline for d1uz5a1: