SCOPe 2.08: Domain d1uz5a1: 1uz5 A:329-402

Lineage for d1uz5a1 (1uz5 A:329-402)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.6: MoeA C-terminal domain-like [63867] (2 families)
   automatically mapped to Pfam PF03454

5. Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins)

6. Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (4 species)

7. Species Pyrococcus horikoshii, PH0582 [TaxId:53953] [102009] (1 PDB entry)

8. Domain d1uz5a1: 1uz5 A:329-402 [100217]
   Other proteins in same PDB: d1uz5a2, d1uz5a3
   complexed with so4

Details for d1uz5a1

PDB Entry: 1uz5, 2.05 Å

PDB Description: the crystal structure of molybdopterin biosynthesis moea protein from pyrococcus horikosii

PDB Compounds: (A:) 402aa long hypothetical molybdopterin biosynthesis moea protein

SCOPe Domain Sequences for d1uz5a1:

Sequence, based on SEQRES records:

>d1uz5a1 b.85.6.1 (A:329-402) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Pyrococcus horikoshii, PH0582 [TaxId: 53953]}
igkkvarlkhkvfsvkgrrqflpvklegdlavpilkgsgavtsfidadgfveipetvesl
degeevevtlfkgw

Sequence, based on observed residues (ATOM records):

>d1uz5a1 b.85.6.1 (A:329-402) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Pyrococcus horikoshii, PH0582 [TaxId: 53953]}
igkkvarlkhkvfsvrrqflpvklegdlavpilkgsgavtsfidadgfveipetveslde
geevevtlfkgw

Timeline for d1uz5a1:

• d1uz5a1 first appeared in SCOP 1.67
  
• d1uz5a1 appears in SCOPe 2.07