Lineage for d1uz5a2 (1uz5 A:5-180)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820794Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
    complex fold made of bifurcated and coiled b-sheets
  4. 2820795Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) (S)
    automatically mapped to Pfam PF03453
  5. 2820796Family b.103.1.1: MoeA N-terminal region -like [63883] (3 proteins)
  6. 2820804Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (4 species)
  7. 2820839Species Pyrococcus horikoshii, PH0582 [TaxId:53953] [102016] (1 PDB entry)
  8. 2820840Domain d1uz5a2: 1uz5 A:5-180 [100218]
    Other proteins in same PDB: d1uz5a1, d1uz5a3
    complexed with so4

Details for d1uz5a2

PDB Entry: 1uz5 (more details), 2.05 Å

PDB Description: the crystal structure of molybdopterin biosynthesis moea protein from pyrococcus horikosii
PDB Compounds: (A:) 402aa long hypothetical molybdopterin biosynthesis moea protein

SCOPe Domain Sequences for d1uz5a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uz5a2 b.103.1.1 (A:5-180) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Pyrococcus horikoshii, PH0582 [TaxId: 53953]}
kvvplekalevvqsfkispgieevpiekglgriaaediyspidvppfdratvdgyavrae
dtfmaseaspvrlkvigsvhageepkfklgkgeaayistgamlpgnadaviqfedvervn
geiliykpaypglgvmkkgidiekgrllvkkgerlgfkqtallsavginkvkvfrk

SCOPe Domain Coordinates for d1uz5a2:

Click to download the PDB-style file with coordinates for d1uz5a2.
(The format of our PDB-style files is described here.)

Timeline for d1uz5a2: