Lineage for d1uysc2 (1uys C:1815-2190)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (9 proteins)
    Pfam PF01039
    the active site is formed by two different homologous subunits or domains of this fold
  6. Protein Acetyl-coenzyme A carboxylase, C-terminal domain [418957] (1 species)
    protein duplication: consists of two similar structural domains forming a functional domain of a larger multifunctional enzyme
  7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [419417] (8 PDB entries)
    Uniprot Q00955
  8. Domain d1uysc2: 1uys C:1815-2190 [100197]
    Other proteins in same PDB: d1uysa1, d1uysb1, d1uysc1
    complexed with h1l

Details for d1uysc2

PDB Entry: 1uys (more details), 2.8 Å

PDB Description: Acetyl-CoA carboxylase carboxyltransferase domain in complex with inhibitor haloxyfop
PDB Compounds: (C:) acetyl-coa carboxylase

SCOPe Domain Sequences for d1uysc2:

Sequence, based on SEQRES records: (download)

>d1uysc2 c.14.1.4 (C:1815-2190) Acetyl-coenzyme A carboxylase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nmpvpiletkdtwdrpvdftptndetydvrwmiegretesgfeyglfdkgsffetlsgwa
kgvvvgrarlggiplgvigvetrtvenlipadpanpnsaetliqepgqvwhpnsafktaq
aindfnngeqlpmmilanwrgfsggqrdmfnevlkygsfivdalvdykqpiiiyipptge
lrggswvvvdptinadqmemyadvnaragvlepqgmvgikfrreklldtmnrlddkyrel
rsqlsnkslapevhqqiskqladrerellpiygqislqfadlhdrssrmvakgviskele
wtearrfffwrlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrqvatw
ieenyktlddklkglk

Sequence, based on observed residues (ATOM records): (download)

>d1uysc2 c.14.1.4 (C:1815-2190) Acetyl-coenzyme A carboxylase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nmpvpiletkdtwdrpvdftptndetydvrwmiegretesgfeyglfdkgsffetlsgwa
kgvvvgrarlggiplgvigvetrtvenlipadpanpnsaetliqepgqvwhpnsafktaq
aindfnngeqlpmmilanwrgfsgnevlkygsfivdalvdykqpiiiyipptgelrggsw
vvvdptinadqmemyadvnaragvlepqgmvgikfrreklldtmnrlellpiygqislqf
adlhdrssrmvakgviskelewtearrfffwrlrrrlneeylikrlshqvgeasrlekia
rirswypasvdheddrqvatwieenyktlddklkglk

SCOPe Domain Coordinates for d1uysc2 are not available.

Timeline for d1uysc2:

Domains from same chain:
(mouse over for more information)
d1uysc1
Domains from other chains:
(mouse over for more information)
d1uysa1, d1uysa2, d1uysb1, d1uysb2