Lineage for d1uysc2 (1uys C:1815-2190)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 390233Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 390234Superfamily c.14.1: ClpP/crotonase [52096] (4 families) (S)
  5. 390387Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (3 proteins)
    the active site is formed by two different homologous subunits or domains of this fold
  6. 390388Protein Acetyl-coenzyme A carboxylase [89573] (1 species)
    duplication: consists of two similar structural domains forming a functional domain of a larger multifunctional enzyme
  7. 390389Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [89574] (6 PDB entries)
  8. 390417Domain d1uysc2: 1uys C:1815-2190 [100197]
    complexed with h1l

Details for d1uysc2

PDB Entry: 1uys (more details), 2.8 Å

PDB Description: Acetyl-CoA carboxylase carboxyltransferase domain in complex with inhibitor haloxyfop

SCOP Domain Sequences for d1uysc2:

Sequence, based on SEQRES records: (download)

>d1uysc2 c.14.1.4 (C:1815-2190) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae)}
nmpvpiletkdtwdrpvdftptndetydvrwmiegretesgfeyglfdkgsffetlsgwa
kgvvvgrarlggiplgvigvetrtvenlipadpanpnsaetliqepgqvwhpnsafktaq
aindfnngeqlpmmilanwrgfsggqrdmfnevlkygsfivdalvdykqpiiiyipptge
lrggswvvvdptinadqmemyadvnaragvlepqgmvgikfrreklldtmnrlddkyrel
rsqlsnkslapevhqqiskqladrerellpiygqislqfadlhdrssrmvakgviskele
wtearrfffwrlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrqvatw
ieenyktlddklkglk

Sequence, based on observed residues (ATOM records): (download)

>d1uysc2 c.14.1.4 (C:1815-2190) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae)}
nmpvpiletkdtwdrpvdftptndetydvrwmiegretesgfeyglfdkgsffetlsgwa
kgvvvgrarlggiplgvigvetrtvenlipadpanpnsaetliqepgqvwhpnsafktaq
aindfnngeqlpmmilanwrgfsgnevlkygsfivdalvdykqpiiiyipptgelrggsw
vvvdptinadqmemyadvnaragvlepqgmvgikfrreklldtmnrlellpiygqislqf
adlhdrssrmvakgviskelewtearrfffwrlrrrlneeylikrlshqvgeasrlekia
rirswypasvdheddrqvatwieenyktlddklkglk

SCOP Domain Coordinates for d1uysc2:

Click to download the PDB-style file with coordinates for d1uysc2.
(The format of our PDB-style files is described here.)

Timeline for d1uysc2: