PDB entry 1uys

View 1uys on RCSB PDB site
Description: Acetyl-CoA carboxylase carboxyltransferase domain in complex with inhibitor haloxyfop
Class: transferase
Keywords: transferase, carboxylase, carboxyltransferase, haloxyfop, transferase herbicide
Deposited on 2004-03-02, released 2004-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-06-20, with a file datestamp of 2012-06-15.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.218
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetyl-coa carboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uysa1, d1uysa2
  • Chain 'B':
    Compound: acetyl-coa carboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uysb1, d1uysb2
  • Chain 'C':
    Compound: acetyl-coa carboxylase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uysc1, d1uysc2
  • Heterogens: H1L, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uysA (A:)
    piatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisne
    liedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqed
    effnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltse
    gmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhd
    iftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtq
    imynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndety
    dvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtven
    lipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsggqr
    dmfnevlkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnar
    agvlepqgmvgikfrreklldtmnrlddkyrelrsqlsnkslapevhqqiskqladrere
    llpiygqislqfadlhdrssrmvakgviskelewtearrfffwrlrrrlneeylikrlsh
    qvgeasrlekiarirswypasvdheddrqvatwieenyktlddklkglklesfaqdlakk
    irsdhdnaidglsevik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uysA (A:)
    piatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisne
    liedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqed
    effnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltse
    gmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhd
    iftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtq
    imynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndety
    dvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtven
    lipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsgnev
    lkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnaragvlep
    qgmvgikfrreklldtmnrlellpiygqislqfadlhdrssrmvakgviskelewtearr
    fffwrlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrqvatwieenyk
    tlddklkglk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uysB (B:)
    piatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisne
    liedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqed
    effnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltse
    gmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhd
    iftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtq
    imynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndety
    dvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtven
    lipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsggqr
    dmfnevlkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnar
    agvlepqgmvgikfrreklldtmnrlddkyrelrsqlsnkslapevhqqiskqladrere
    llpiygqislqfadlhdrssrmvakgviskelewtearrfffwrlrrrlneeylikrlsh
    qvgeasrlekiarirswypasvdheddrqvatwieenyktlddklkglklesfaqdlakk
    irsdhdnaidglsevik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uysB (B:)
    piatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisne
    liedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqed
    effnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltse
    gmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhd
    iftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtq
    imynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndety
    dvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtven
    lipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsgnev
    lkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnaragvlep
    qgmvgikfrreklldtmnrlellpiygqislqfadlhdrssrmvakgviskelewtearr
    fffwrlrrrlneeylikrlshqvgeasrlekiarirswypasvdheddrqvatwieenyk
    tlddklkglk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1uysC (C:)
    piatpypvkewlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisne
    liedengelteverepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqed
    effnkvteyarkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltse
    gmetlkkfdkensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhd
    iftitlvtcrsvgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtq
    imynngvshltavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndety
    dvrwmiegretesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtven
    lipadpanpnsaetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsggqr
    dmfnevlkygsfivdalvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnar
    agvlepqgmvgikfrreklldtmnrlddkyrelrsqlsnkslapevhqqiskqladrere
    llpiygqislqfadlhdrssrmvakgviskelewtearrfffwrlrrrlneeylikrlsh
    qvgeasrlekiarirswypasvdheddrqvatwieenyktlddklkglklesfaqdlakk
    irsdhdnaidglsevik
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uysC (C:)
    wlqpkrykahlmgttyvydfpelfrqasssqwknfsadvkltddffisneliedengelt
    everepganaigmvafkitvktpeyprgrqfvvvanditfkigsfgpqedeffnkvteya
    rkrgipriylaansgarigmaeeivplfqvawndaanpdkgfqylyltsegmetlkkfdk
    ensvltertvingeerfviktiigsedglgveclrgsgliagatsrayhdiftitlvtcr
    svgigaylvrlgqraiqvegqpiiltgapainkmlgrevytsnlqlggtqimynngvshl
    tavddlagvekivewmsyvpakrnmpvpiletkdtwdrpvdftptndetydvrwmiegre
    tesgfeyglfdkgsffetlsgwakgvvvgrarlggiplgvigvetrtvenlipadpanpn
    saetliqepgqvwhpnsafktaqaindfnngeqlpmmilanwrgfsgnevlkygsfivda
    lvdykqpiiiyipptgelrggswvvvdptinadqmemyadvnaragvlepqgmvgikfrr
    eklldtmnrlellpiygqislqfadlhdrssrmvakgviskelewtearrfffwrlrrrl
    neeylikrlshqvgeasrlekiarirswypasvdheddrqvatwieenyktlddklkglk