Lineage for d1uxlj_ (1uxl J:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [49333] (96 PDB entries)
  8. Domain d1uxlj_: 1uxl J: [100156]
    complexed with cu, so4, zn; mutant

Details for d1uxlj_

PDB Entry: 1uxl (more details), 1.6 Å

PDB Description: i113t mutant of human sod1
PDB Compounds: (J:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d1uxlj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uxlj_ b.1.8.1 (J:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhcitgrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

SCOPe Domain Coordinates for d1uxlj_ are not available.

Timeline for d1uxlj_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1uxla_, d1uxlb_, d1uxlc_, d1uxld_, d1uxle_, d1uxlf_, d1uxlg_, d1uxlh_, d1uxli_