![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) ![]() has additional strand at N-terminus |
![]() | Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins) |
![]() | Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49333] (22 PDB entries) |
![]() | Domain d1uxlj_: 1uxl J: [100156] complexed with cu, so4, zn; mutant |
PDB Entry: 1uxl (more details), 1.6 Å
SCOP Domain Sequences for d1uxlj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uxlj_ b.1.8.1 (J:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens)} atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhcitgrtlvvh ekaddlgkggneestktgnagsrlacgvigiaq
Timeline for d1uxlj_: