Lineage for d1uxlg_ (1uxl G:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763708Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2763709Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2763729Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 2763832Species Human (Homo sapiens) [TaxId:9606] [49333] (96 PDB entries)
  8. 2763879Domain d1uxlg_: 1uxl G: [100153]
    complexed with cu, so4, zn; mutant

Details for d1uxlg_

PDB Entry: 1uxl (more details), 1.6 Å

PDB Description: i113t mutant of human sod1
PDB Compounds: (G:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d1uxlg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uxlg_ b.1.8.1 (G:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]}
atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhcitgrtlvvh
ekaddlgkggneestktgnagsrlacgvigiaq

SCOPe Domain Coordinates for d1uxlg_:

Click to download the PDB-style file with coordinates for d1uxlg_.
(The format of our PDB-style files is described here.)

Timeline for d1uxlg_: