Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) has additional strand at N-terminus |
Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species) |
Species Human (Homo sapiens) [TaxId:9606] [49333] (96 PDB entries) |
Domain d1uxlg_: 1uxl G: [100153] complexed with cu, so4, zn; mutant |
PDB Entry: 1uxl (more details), 1.6 Å
SCOPe Domain Sequences for d1uxlg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uxlg_ b.1.8.1 (G:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens) [TaxId: 9606]} atkavcvlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhcitgrtlvvh ekaddlgkggneestktgnagsrlacgvigiaq
Timeline for d1uxlg_: