Lineage for d1ux6a1 (1ux6 A:937-1152)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2043975Family b.29.1.16: Thrombospondin C-terminal domain [101643] (1 protein)
    Pfam PF05735
  6. 2043976Protein Thrombospondin C-terminal domain [101644] (1 species)
  7. 2043977Species Human (Homo sapiens) [TaxId:9606] [101645] (1 PDB entry)
  8. 2043978Domain d1ux6a1: 1ux6 A:937-1152 [100145]
    Other proteins in same PDB: d1ux6a2
    complexed with ca

Details for d1ux6a1

PDB Entry: 1ux6 (more details), 1.9 Å

PDB Description: structure of a thrombospondin c-terminal fragment reveals a novel calcium core in the type 3 repeats
PDB Compounds: (A:) Thrombospondin-1

SCOPe Domain Sequences for d1ux6a1:

Sequence, based on SEQRES records: (download)

>d1ux6a1 b.29.1.16 (A:937-1152) Thrombospondin C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
tdfrrfqmipldpkgtsqndpnwvvrhqgkelvqtvnsdpglavgydefnavdfsgtffi
nterdddyagfvfgyqsssrfyvvmwkqvtqsywdtnptraqgysglsvkvvksttgpge
hlrnalwhtgntpgqvrtlwhdprhigwkdftayrwrlshrpktgfirvvmyegkkimad
sgpiydktyaggrlglfvfsqemvffsdlkyecrdp

Sequence, based on observed residues (ATOM records): (download)

>d1ux6a1 b.29.1.16 (A:937-1152) Thrombospondin C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
tdfrrfqmipldpkgtsqndpnwvvelvqtvnsdpglavgydefnavdfsgtffinterd
ddyagfvfgyqsssrfyvvmwkqvtqsywdtnptraqgysglsvkvvksttgpgehlrna
lwhtgntpgqvrtlwhdprhigwkdftayrwrlshrpktgfirvvmyegkkimadsgpiy
dktyaggrlglfvfsqemvffsdlkyecrdp

SCOPe Domain Coordinates for d1ux6a1:

Click to download the PDB-style file with coordinates for d1ux6a1.
(The format of our PDB-style files is described here.)

Timeline for d1ux6a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ux6a2