PDB entry 1ux6

View 1ux6 on RCSB PDB site
Description: Structure of a thrombospondin C-terminal fragment reveals a novel calcium core in the type 3 repeats
Class: cell adhesion
Keywords: extracellular matrix, calcium binding, l-type lectin, glycoprotein, cell adhesion, calcium-binding, heparin-binding, egf-like domain
Deposited on 2004-02-19, released 2004-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-12, with a file datestamp of 2017-07-07.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thrombospondin-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1UX6
      • engineered mutation (171)
      • engineered mutation (246)
    • Uniprot P07996 (10-349)
    Domains in SCOPe 2.07: d1ux6a1, d1ux6a2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ux6A (A:)
    aplvhhhhhhaladncplehnpdqldsdsdrigdtcdnnqdidedghqnnldncpyvpna
    nqadhdkdgkgdacdhdddndgipddkdncrlvpnpdqkdsdgdgrgdackddfdhdsvp
    diddicpenvdisetdfrrfqmipldpkgtsqndpnwvvrhqgkelvqtvnsdpglavgy
    defnavdfsgtffinterdddyagfvfgyqsssrfyvvmwkqvtqsywdtnptraqgysg
    lsvkvvksttgpgehlrnalwhtgntpgqvrtlwhdprhigwkdftayrwrlshrpktgf
    irvvmyegkkimadsgpiydktyaggrlglfvfsqemvffsdlkyecrdp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ux6A (A:)
    aladncplehnpdqldsdsdrigdtcdnnqdidedghqnnldncpyvpnanqadhdkdgk
    gdacdhdddndgipddkdncrlvpnpdqkdsdgdgrgdackddfdhdsvpdiddicpenv
    disetdfrrfqmipldpkgtsqndpnwvvelvqtvnsdpglavgydefnavdfsgtffin
    terdddyagfvfgyqsssrfyvvmwkqvtqsywdtnptraqgysglsvkvvksttgpgeh
    lrnalwhtgntpgqvrtlwhdprhigwkdftayrwrlshrpktgfirvvmyegkkimads
    gpiydktyaggrlglfvfsqemvffsdlkyecrdp