![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.75: TSP type-3 repeat [103646] (1 superfamily) metal(calcium)-bound fold |
![]() | Superfamily g.75.1: TSP type-3 repeat [103647] (1 family) ![]() |
![]() | Family g.75.1.1: TSP type-3 repeat [103648] (1 protein) this is a repeat family; one repeat unit is 1ux6 A:864-900 found in domain |
![]() | Protein Thrombospondin-1 [103649] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [103650] (1 PDB entry) |
![]() | Domain d1ux6a2: 1ux6 A:813-936 [100146] Other proteins in same PDB: d1ux6a1 repeats from 4 to 7 complexed with ca |
PDB Entry: 1ux6 (more details), 1.9 Å
SCOPe Domain Sequences for d1ux6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ux6a2 g.75.1.1 (A:813-936) Thrombospondin-1 {Human (Homo sapiens) [TaxId: 9606]} aladncplehnpdqldsdsdrigdtcdnnqdidedghqnnldncpyvpnanqadhdkdgk gdacdhdddndgipddkdncrlvpnpdqkdsdgdgrgdackddfdhdsvpdiddicpenv dise
Timeline for d1ux6a2: