SCOPe 2.08: Domain d1ux6a2: 1ux6 A:813-936

Lineage for d1ux6a2 (1ux6 A:813-936)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.75: TSP type-3 repeat [103646] (1 superfamily)
   metal(calcium)-bound fold

4. Superfamily g.75.1: TSP type-3 repeat [103647] (1 family)

5. Family g.75.1.1: TSP type-3 repeat [103648] (1 protein)
   this is a repeat family; one repeat unit is 1ux6 A:864-900 found in domain

6. Protein Thrombospondin-1 [103649] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103650] (1 PDB entry)

8. Domain d1ux6a2: 1ux6 A:813-936 [100146]
   Other proteins in same PDB: d1ux6a1
   repeats from 4 to 7
   complexed with ca

Details for d1ux6a2

PDB Entry: 1ux6, 1.9 Å

PDB Description: structure of a thrombospondin c-terminal fragment reveals a novel calcium core in the type 3 repeats

PDB Compounds: (A:) Thrombospondin-1

SCOPe Domain Sequences for d1ux6a2:

Sequence; same for both SEQRES and ATOM records:

>d1ux6a2 g.75.1.1 (A:813-936) Thrombospondin-1 {Human (Homo sapiens) [TaxId: 9606]}
aladncplehnpdqldsdsdrigdtcdnnqdidedghqnnldncpyvpnanqadhdkdgk
gdacdhdddndgipddkdncrlvpnpdqkdsdgdgrgdackddfdhdsvpdiddicpenv
dise

Timeline for d1ux6a2:

• d1ux6a2 first appeared in SCOP 1.67
  
• d1ux6a2 appears in SCOPe 2.07