Lineage for d1uvoa_ (1uvo A:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. Protein Elastase [50536] (4 species)
  7. Species Pig (Sus scrofa) [TaxId:9823] [50538] (123 PDB entries)
  8. Domain d1uvoa_: 1uvo A: [100060]
    complexed with act, cd, cl, gol

Details for d1uvoa_

PDB Entry: 1uvo (more details), 1.85 Å

PDB Description: structure of the complex of porcine pancreatic elastase in complex with cadmium refined at 1.85 a resolution (crystal a)
PDB Compounds: (A:) Elastase 1

SCOPe Domain Sequences for d1uvoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uvoa_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqndgteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

SCOPe Domain Coordinates for d1uvoa_ are not available.

Timeline for d1uvoa_: