SCOP 1.67: Domain d1uvoa_: 1uvo A:

Lineage for d1uvoa_ (1uvo A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (44 proteins)

6. Protein Elastase [50536] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50538] (59 PDB entries)

8. Domain d1uvoa_: 1uvo A: [100060]
   complexed with act, cd, cl, gol

Details for d1uvoa_

PDB Entry: 1uvo, 1.85 Å

PDB Description: structure of the complex of porcine pancreatic elastase in complex with cadmium refined at 1.85 a resolution (crystal a)

SCOP Domain Sequences for d1uvoa_:

Sequence; same for both SEQRES and ATOM records:

>d1uvoa_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa)}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqndgteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

Timeline for d1uvoa_:

• d1uvoa_ is new in SCOP 1.67
  
• d1uvoa_ appears in SCOP 1.69
  
• d1uvoa_ appears in the current release, SCOPe 2.08