Lineage for d1uvoa_ (1uvo A:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 376039Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 376040Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 376157Family b.47.1.2: Eukaryotic proteases [50514] (44 proteins)
  6. 376346Protein Elastase [50536] (4 species)
  7. 376358Species Pig (Sus scrofa) [TaxId:9823] [50538] (59 PDB entries)
  8. 376381Domain d1uvoa_: 1uvo A: [100060]
    complexed with act, cd, cl, gol

Details for d1uvoa_

PDB Entry: 1uvo (more details), 1.85 Å

PDB Description: structure of the complex of porcine pancreatic elastase in complex with cadmium refined at 1.85 a resolution (crystal a)

SCOP Domain Sequences for d1uvoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uvoa_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa)}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqndgteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

SCOP Domain Coordinates for d1uvoa_:

Click to download the PDB-style file with coordinates for d1uvoa_.
(The format of our PDB-style files is described here.)

Timeline for d1uvoa_: