SCOPe 2.08: Domain d1uuza1: 1uuz A:1-129

Lineage for d1uuza1 (1uuz A:1-129)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.233: Inhibitor of vertebrate lysozyme, Ivy [89871] (1 superfamily)
   alpha(2)-beta(5)-alpha(2); 3 layers a/b/a; meander beta-sheet

4. Superfamily d.233.1: Inhibitor of vertebrate lysozyme, Ivy [89872] (1 family)
   automatically mapped to Pfam PF08816

5. Family d.233.1.1: Inhibitor of vertebrate lysozyme, Ivy [89873] (2 proteins)

6. Protein Inhibitor of vertebrate lysozyme, Ivy [89874] (2 species)
   formerly hypothetical protein YkfE

7. Species Pseudomonas aeruginosa [TaxId:287] [89876] (2 PDB entries)

8. Domain d1uuza1: 1uuz A:1-129 [100024]
   Other proteins in same PDB: d1uuza2, d1uuzb2, d1uuzc_, d1uuzd_
   complexed with lysozyme

Details for d1uuza1

PDB Entry: 1uuz, 1.8 Å

PDB Description: ivy:a new family of protein

PDB Compounds: (A:) inhibitor of vertebrate lysozyme

SCOPe Domain Sequences for d1uuza1:

Sequence; same for both SEQRES and ATOM records:

>d1uuza1 d.233.1.1 (A:1-129) Inhibitor of vertebrate lysozyme, Ivy {Pseudomonas aeruginosa [TaxId: 287]}
eeqprlfellgqpgykatwhamfkgesdvpkwvsdasgpsspstslslegqpyvlansck
phdcgnnrllvafrgdksaayglqvslpdepaevmqtpskyatyrwygepsrqvrellmk
qlesdpnwk

Timeline for d1uuza1:

• d1uuza1 first appeared in SCOP 1.67, called d1uuza_
  
• d1uuza1 appears in SCOPe 2.07