SCOP 1.67: Domain d1uuza_: 1uuz A:

Lineage for d1uuza_ (1uuz A:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.233: Inhibitor of vertebrate lysozyme, Ivy [89871] (1 superfamily)
   alpha(2)-beta(5)-alpha(2); 3 layers a/b/a; meander beta-sheet

4. Superfamily d.233.1: Inhibitor of vertebrate lysozyme, Ivy [89872] (1 family)

5. Family d.233.1.1: Inhibitor of vertebrate lysozyme, Ivy [89873] (1 protein)

6. Protein Inhibitor of vertebrate lysozyme, Ivy [89874] (2 species)
   formerly hypothetical protein YkfE

7. Species Pseudomonas aeruginosa [TaxId:287] [89876] (1 PDB entry)

8. Domain d1uuza_: 1uuz A: [100024]
   Other proteins in same PDB: d1uuzc_, d1uuzd_

Details for d1uuza_

PDB Entry: 1uuz, 1.8 Å

PDB Description: ivy:a new family of protein

SCOP Domain Sequences for d1uuza_:

Sequence; same for both SEQRES and ATOM records:

>d1uuza_ d.233.1.1 (A:) Inhibitor of vertebrate lysozyme, Ivy {Pseudomonas aeruginosa}
eeqprlfellgqpgykatwhamfkgesdvpkwvsdasgpsspstslslegqpyvlansck
phdcgnnrllvafrgdksaayglqvslpdepaevmqtpskyatyrwygepsrqvrellmk
qlesdpnwkl

Timeline for d1uuza_:

• d1uuza_ is new in SCOP 1.67
  
• d1uuza_ appears in SCOP 1.69
  
• d1uuza_ appears in the current release, SCOPe 2.08, called d1uuza1