Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.233: Inhibitor of vertebrate lysozyme, Ivy [89871] (1 superfamily) alpha(2)-beta(5)-alpha(2); 3 layers a/b/a; meander beta-sheet |
Superfamily d.233.1: Inhibitor of vertebrate lysozyme, Ivy [89872] (1 family) automatically mapped to Pfam PF08816 |
Family d.233.1.1: Inhibitor of vertebrate lysozyme, Ivy [89873] (2 proteins) |
Protein Inhibitor of vertebrate lysozyme, Ivy [89874] (2 species) formerly hypothetical protein YkfE |
Species Pseudomonas aeruginosa [TaxId:287] [89876] (2 PDB entries) |
Domain d1uuzb1: 1uuz B:2-129 [100025] Other proteins in same PDB: d1uuza2, d1uuzb2, d1uuzc_, d1uuzd_ complexed with lysozyme |
PDB Entry: 1uuz (more details), 1.8 Å
SCOPe Domain Sequences for d1uuzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uuzb1 d.233.1.1 (B:2-129) Inhibitor of vertebrate lysozyme, Ivy {Pseudomonas aeruginosa [TaxId: 287]} eqprlfellgqpgykatwhamfkgesdvpkwvsdasgpsspstslslegqpyvlansckp hdcgnnrllvafrgdksaayglqvslpdepaevmqtpskyatyrwygepsrqvrellmkq lesdpnwk
Timeline for d1uuzb1:
View in 3D Domains from other chains: (mouse over for more information) d1uuza1, d1uuza2, d1uuzc_, d1uuzd_ |