Lineage for d1uutb_ (1uut B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2528607Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. 2528608Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families) (S)
  5. 2528655Family d.89.1.3: Replication protein Rep, nuclease domain [75492] (2 proteins)
    automatically mapped to Pfam PF08724
  6. 2528656Protein Replication protein Rep, nuclease domain [75493] (1 species)
  7. 2528657Species Adeno-associated virus, aav-5 [TaxId:272636] [75494] (3 PDB entries)
  8. 2528661Domain d1uutb_: 1uut B: [100023]
    protein/DNA complex; complexed with cl, mg

Details for d1uutb_

PDB Entry: 1uut (more details), 2 Å

PDB Description: the nuclease domain of adeno-associated virus rep complexed with the rbe' stemloop of the viral inverted terminal repeat
PDB Compounds: (B:) Rep protein

SCOPe Domain Sequences for d1uutb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uutb_ d.89.1.3 (B:) Replication protein Rep, nuclease domain {Adeno-associated virus, aav-5 [TaxId: 272636]}
matfyevivrvpfdveehlpgisdsfvdwvtgqiwelppesdlnltlveqpqltvadrir
rvflyewnkfskqeskffvqfekgseyfhlhtlvetsgissmvlgryvsqiraqlvkvvf
qgiepqindwvaitkvkkggankvvdsgyipayllpkvqpelqwawtnldeyklaalnle
erkrlvaqflaessq

SCOPe Domain Coordinates for d1uutb_:

Click to download the PDB-style file with coordinates for d1uutb_.
(The format of our PDB-style files is described here.)

Timeline for d1uutb_: