SCOPe 2.08: Domain d1uutb_: 1uut B:

Lineage for d1uutb_ (1uut B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
   alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325

4. Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families)

5. Family d.89.1.3: Replication protein Rep, nuclease domain [75492] (2 proteins)
   automatically mapped to Pfam PF08724

6. Protein Replication protein Rep, nuclease domain [75493] (1 species)

7. Species Adeno-associated virus, aav-5 [TaxId:272636] [75494] (3 PDB entries)

8. Domain d1uutb_: 1uut B: [100023]
   protein/DNA complex; complexed with cl, mg

Details for d1uutb_

PDB Entry: 1uut, 2 Å

PDB Description: the nuclease domain of adeno-associated virus rep complexed with the rbe' stemloop of the viral inverted terminal repeat

PDB Compounds: (B:) Rep protein

SCOPe Domain Sequences for d1uutb_:

Sequence; same for both SEQRES and ATOM records:

>d1uutb_ d.89.1.3 (B:) Replication protein Rep, nuclease domain {Adeno-associated virus, aav-5 [TaxId: 272636]}
matfyevivrvpfdveehlpgisdsfvdwvtgqiwelppesdlnltlveqpqltvadrir
rvflyewnkfskqeskffvqfekgseyfhlhtlvetsgissmvlgryvsqiraqlvkvvf
qgiepqindwvaitkvkkggankvvdsgyipayllpkvqpelqwawtnldeyklaalnle
erkrlvaqflaessq

Timeline for d1uutb_:

• d1uutb_ first appeared in SCOP 1.67
  
• d1uutb_ appears in SCOPe 2.07