![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily) alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325 |
![]() | Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families) ![]() |
![]() | Family d.89.1.3: Replication protein Rep, nuclease domain [75492] (2 proteins) automatically mapped to Pfam PF08724 |
![]() | Protein Replication protein Rep, nuclease domain [75493] (1 species) |
![]() | Species Adeno-associated virus, aav-5 [TaxId:272636] [75494] (3 PDB entries) |
![]() | Domain d1uuta_: 1uut A: [100022] protein/DNA complex; complexed with cl, mg |
PDB Entry: 1uut (more details), 2 Å
SCOPe Domain Sequences for d1uuta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uuta_ d.89.1.3 (A:) Replication protein Rep, nuclease domain {Adeno-associated virus, aav-5 [TaxId: 272636]} matfyevivrvpfdveehlpgisdsfvdwvtgqiwelppesdlnltlveqpqltvadrir rvflyewnkfskqeskffvqfekgseyfhlhtlvetsgissmvlgryvsqiraqlvkvvf qgiepqindwvaitkvkkggankvvdsgyipayllpkvqpelqwawtnldeyklaalnle erkrlvaqflaessq
Timeline for d1uuta_: