Lineage for d1uuta_ (1uut A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families) (S)
  5. Family d.89.1.3: Replication protein Rep, nuclease domain [75492] (2 proteins)
    automatically mapped to Pfam PF08724
  6. Protein Replication protein Rep, nuclease domain [75493] (1 species)
  7. Species Adeno-associated virus, aav-5 [TaxId:272636] [75494] (3 PDB entries)
  8. Domain d1uuta_: 1uut A: [100022]
    protein/DNA complex; complexed with cl, mg

Details for d1uuta_

PDB Entry: 1uut (more details), 2 Å

PDB Description: the nuclease domain of adeno-associated virus rep complexed with the rbe' stemloop of the viral inverted terminal repeat
PDB Compounds: (A:) Rep protein

SCOPe Domain Sequences for d1uuta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1uuta_ d.89.1.3 (A:) Replication protein Rep, nuclease domain {Adeno-associated virus, aav-5 [TaxId: 272636]}
matfyevivrvpfdveehlpgisdsfvdwvtgqiwelppesdlnltlveqpqltvadrir
rvflyewnkfskqeskffvqfekgseyfhlhtlvetsgissmvlgryvsqiraqlvkvvf
qgiepqindwvaitkvkkggankvvdsgyipayllpkvqpelqwawtnldeyklaalnle
erkrlvaqflaessq

SCOPe Domain Coordinates for d1uuta_ are not available.

Timeline for d1uuta_:

Domains from other chains:
(mouse over for more information)
d1uutb_