PDB entry 1uut

View 1uut on RCSB PDB site
Description: the nuclease domain of adeno-associated virus rep complexed with the rbe' stemloop of the viral inverted terminal repeat
Class: hydrolase/DNA
Keywords: hydrolase/DNA, nuclease/complex, viral protein, nuclease, replication, protein-DNA, stemloop, helicase
Deposited on 2004-01-10, released 2004-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.195
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rep protein
    Species: ADENO-ASSOCIATED VIRUS 5 [TaxId:82300]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uuta_
  • Chain 'B':
    Compound: Rep protein
    Species: ADENO-ASSOCIATED VIRUS 5 [TaxId:82300]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1uutb_
  • Chain 'C':
    Compound: 5'-d(*cp*ap*gp*cp*tp*cp*tp*tp*tp*gp *ap*gp*cp*tp*g)-3'
    Species: ADENO-ASSOCIATED VIRUS 5, synthetic [TaxId:82300]
  • Chain 'D':
    Compound: 5'-d(*cp*ap*gp*cp*tp*cp*tp*tp*tp*gp *ap*gp*cp*tp*g)-3'
    Species: ADENO-ASSOCIATED VIRUS 5, synthetic [TaxId:82300]
  • Heterogens: MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1uutA (A:)
    matfyevivrvpfdveehlpgisdsfvdwvtgqiwelppesdlnltlveqpqltvadrir
    rvflyewnkfskqeskffvqfekgseyfhlhtlvetsgissmvlgryvsqiraqlvkvvf
    qgiepqindwvaitkvkkggankvvdsgyipayllpkvqpelqwawtnldeyklaalnle
    erkrlvaqflaessqrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uutA (A:)
    matfyevivrvpfdveehlpgisdsfvdwvtgqiwelppesdlnltlveqpqltvadrir
    rvflyewnkfskqeskffvqfekgseyfhlhtlvetsgissmvlgryvsqiraqlvkvvf
    qgiepqindwvaitkvkkggankvvdsgyipayllpkvqpelqwawtnldeyklaalnle
    erkrlvaqflaessq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1uutB (B:)
    matfyevivrvpfdveehlpgisdsfvdwvtgqiwelppesdlnltlveqpqltvadrir
    rvflyewnkfskqeskffvqfekgseyfhlhtlvetsgissmvlgryvsqiraqlvkvvf
    qgiepqindwvaitkvkkggankvvdsgyipayllpkvqpelqwawtnldeyklaalnle
    erkrlvaqflaessqrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1uutB (B:)
    matfyevivrvpfdveehlpgisdsfvdwvtgqiwelppesdlnltlveqpqltvadrir
    rvflyewnkfskqeskffvqfekgseyfhlhtlvetsgissmvlgryvsqiraqlvkvvf
    qgiepqindwvaitkvkkggankvvdsgyipayllpkvqpelqwawtnldeyklaalnle
    erkrlvaqflaessq
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.